Cat: IPD-X36502

Recombinant Rat IL-13R alpha 2 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-13R alpha 2

  • 简介

    IL-13R alpha 2 Protein, functioning as a monomer, exhibits strong affinity for binding to interleukin-13 (IL-13), thereby playing a crucial role in mediating the biological effects of IL-13 and regulating various cellular processes. IL-13R alpha 2 Protein, Rat (HEK293, His) is the recombinant rat-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Interleukin-13 receptor subunit alpha-2; IL-13R-alpha-2; IL-13RA2; CD213a2; IL13RA2; IL13R

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q8VHK6

  • Expression Region

    L24-K336

  • AA Sequence

    LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVMDNFKECKLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWTEASYGIADEGSLGTKIQDMKCIYYNWQYLVCSWKPGKTVHSDTNYTMFFWYEGLDHALQCADYLQDNEKNVGCKLSNLDSSDYKDFFIRVNGSSKLEPIRSSYMVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPSCYTYEIVVREDDISWESATDKNDMKLKRRANESEDLCFFVRCKINIYCADDGIWSEWSEEECWEGYTGPDSK

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-13 receptor alpha 2 (IL-13Rα2) is a protein that plays a crucial role in cytokine signaling, specifically in the immune response mediated by interleukin-13 (IL-13), a key player in allergic reactions and asthma. Elevated levels of IL-13Rα2 have been associated with various pathological conditions, including cancer, where it can contribute to tumor progression and immune evasion. The unique binding affinity of IL-13Rα2 for IL-13, in contrast to its other receptor complexes, makes it a potential target for therapeutic interventions. Research has increasingly focused on the re-engineering of IL-13Rα2 into recombinant proteins for various applications, including targeted drug delivery systems and immunotherapy. By harnessing the specificity of IL-13Rα2, scientists aim to develop innovative treatments that selectively destroy tumor cells while minimizing damage to healthy tissues. Understanding the structural and functional properties of IL-13Rα2, along with its interactions in various disease states, is paramount for advancing treatment strategies and potentially improving outcomes for patients suffering from IL-13-associated diseases. As a result, IL-13Rα2 recombinant proteins are gaining attention in both basic research and clinical settings, paving the way for novel therapeutic avenues.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US