Analytical Data
-
Gene name
L1/VACWR088, Vaccinia virus
-
简介
Protein L1/VACWR088 is a crucial part of the entry fusion complex (EFC) comprising 11 proteins. It facilitates the entry of the virion core into the host cytoplasm through a two-step process involving lipid mixing and pore formation. All EFC proteins, except OPG095/L1 and OPG053/F9, contribute to the assembly or stability of the complex. Protein L1/VACWR088, Vaccinia virus (sf9, His, myc) is the recombinant Virus-derived protein L1/VACWR088, expressed by sf9 insect cells , with N-His, C-Myc labeled tag.
- Application
-
Alternative Names
Virion membrane protein M25
-
Species
Virus
-
Source
Baculovirus
-
Tag
N-His;C-Myc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P07612
-
Expression Region
G2-G183
-
AA Sequence
GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG
-
Protein Length
Partial
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
L1/VACWR088 is a recombinant protein derived from the Vaccinia virus, which is a member of the Poxviridae family. The Vaccinia virus has been extensively studied due to its historical use as the vaccine for smallpox, a disease that has been eradicated through vaccination efforts. Research into L1/VACWR088 is driven by its potential applications in immunology and vaccine development. This recombinant protein serves as a valuable tool for understanding the mechanisms of viral pathogenesis and host immune responses. Additionally, Vaccinia virus proteins like L1/VACWR088 can be engineered for targeted vaccine strategies against various infectious diseases and even cancer. By studying the properties and functions of this recombinant protein, researchers aim to explore its efficacy in stimulating immune responses, which could lead to innovations in vaccine design and therapeutic interventions. The ongoing investigations into L1/VACWR088 exemplify the broader efforts to harness viral proteins for advancing public health and enhancing our understanding of viral interactions with the immune system. As such, the study of L1/VACWR088 holds promise for the development of next-generation vaccines and therapeutic strategies, emphasizing the relevance of Vaccinia virus research in contemporary biomedical science.











