Cat: IPD-X23908

Recombinant Human Vitamin D-binding protein/GC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Vitamin D-binding protein/GC

  • 简介

    GC protein is a multifunctional protein that promotes vitamin D transport and storage while scavenging extracellular G-actin to maintain cellular homeostasis. It enhances the chemotactic activity of C5 alpha toward neutrophils during inflammation, helps macrophage activation, and interacts with B lymphocyte and T lymphocyte membranes, indicating its involvement in the immune process. Vitamin D-binding protein/GC Protein, Human (His) is the recombinant human-derived Vitamin D-binding protein/GC protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P02774-1

  • Expression Region

    R19-L474

  • AA Sequence

    RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL

  • Protein Length

    Partial

  • Molecular Weight

    58 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Vitamin D-binding protein (DBP), also known as Group-specific component (GC), is a multifunctional protein primarily synthesized in the liver, playing a critical role in the transport of vitamin D metabolites in the circulatory system. Its significance extends beyond vitamin D transport, as DBP is involved in several physiological processes, including macrophage activation, immune regulation, and bone metabolism. Given its diverse biological functions, variations in DBP levels have been associated with various health conditions, such as osteoporosis, cardiovascular diseases, and certain cancers. The study of recombinant DBP (rDBP) has gained traction in recent years as researchers seek to understand its structure-function relationship and therapeutic potential. Recombinant techniques allow for the production of DBP in a controlled manner, facilitating investigations into its role in disease pathways and potential applications in clinical settings. Moreover, rDBP can be utilized in diagnostic assays to measure DBP levels in clinical samples, further highlighting the protein's relevance in health monitoring. As ongoing research unveils more about the mechanisms through which DBP influences health, there is growing interest in its potential as a biomarker for disease progression and treatment response, making rDBP a significant focus for both clinical and laboratory research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US