Cat: IPD-X36397

Recombinant Cynomolgus CD127/IL-7RA Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD127/IL-7RA

  • 简介

    IL-7RA (also known as CD127) is a type 1 membrane glycoprotein folded to bind and mediate the action of IL7 and other alpha helical cytokines. IL-7RA is mainly expressed by cells of the lymphoid lineage. IL-7RA also acts as a receptor for thymic stromal lymphopoietin (TSLP). CD127/IL-7RA Protein, Cynomolgus (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 235 amino acids (M1-P235)[1][2].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Interleukin-7 receptor subunit alpha; IL7R; IL-7R-alpha; CD127

  • Species

    Cynomolgus

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q38IC7

  • Expression Region

    E21-P235

  • AA Sequence

    ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLSFRKLQEIYFIETKKFLLIGKSNICVKVGGKSLTCKKIDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWMHVNLSSTKLTLLQRNLQPEAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSP

  • Protein Length

    Partial

  • Molecular Weight

    26.3-50 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD127, also known as interleukin-7 receptor alpha (IL-7RA), plays a crucial role in the immune system by mediating the effects of interleukin-7 (IL-7), a cytokine essential for lymphocyte development and homeostasis. The interaction between IL-7 and its receptor is vital for T cell and B cell maturation, proliferation, and survival. Dysregulation of the IL-7/IL-7RA signaling pathway is implicated in various immunological disorders, including autoimmune diseases and lymphoproliferative disorders. Consequently, recombinant CD127/IL-7RA proteins have garnered significant attention for their potential therapeutic applications. Researchers are investigating these proteins not only to better understand the molecular mechanisms underpinning IL-7 signaling but also to explore their utility in enhancing immune responses, particularly in the context of cancer immunotherapy and in restoring immune function in immunocompromised individuals. Engineering and producing recombinant CD127 allows for in-depth studies on receptor interactions, signaling pathways, and the development of targeted therapies. Furthermore, as the immune landscape evolves with advances in biotechnology, CD127 could serve as a biomarker for immune status and a target for innovative treatments in various diseases, emphasizing the importance of ongoing research in this dynamic field.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US