Cat: IPD-X36383

Recombinant Rat IL-20R beta Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-20R beta

  • 简介

    IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway[1]. The IL-20RA/IL-20RB dimer is a receptor for IL-19, IL-20 and IL-24. The IL-22RA1/IL-20RB dimer is a receptor for IL-20 and IL-24[2]. IL-20R beta Protein is consists of 308 amino acids (M1-T308) with a transmembrane domain (226-249 a.a.). IL-20R beta Protein, Rat (HEK293, Fc) is produced in HEK293 cells with a C-Terminal hFc-tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Human IL-19, at 0.1 μg/mL (100 μL/well) can bind IL-20R beta. The ED50 for this effect is 28.75 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Human IL-19, at 0.1 μg/mL (100 μL/well) can bind IL-20R beta.The ED50 for this effect is 28.75 ng/mL.

  • Alternative Names

    Interleukin-20 receptor subunit beta; IL-20R-beta; IL-20RB; FNDC6; IL-20R2; DIRS1

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    B8K1X9

  • Expression Region

    A27-P227

  • AA Sequence

    ATILPAPQNFSVRSTNMKHLLMWNPVTQPGETVFYFVQYQGEYESLYMSHIWIPSSQCSPTKGLECDVTDDVTATVPYNFRVMAMLGSQSSAWSNLEHPFNRNATVLTPPRMEVTEHGLHLVVELEDLGPQFEFLVVYWRMEPGAVERVKVVRSGDIPVHLETMDPGVMYCVKAQALVKTIGRHSAFSQPTCVEMQGESLP

  • Protein Length

    Partial

  • Molecular Weight

    29-33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-20 receptor beta (IL-20Rβ) is a critical component of the IL-20 receptor complex, which plays a significant role in various inflammatory and immune responses. This receptor is primarily expressed in skin and other epithelial tissues, where it mediates the effects of IL-20, IL-24, and IL-22, cytokines linked to dermatological diseases such as psoriasis and atopic dermatitis. Research has shown that IL-20Rβ signaling influences keratinocyte proliferation and differentiation, making it a potential target for therapeutic interventions. The recombinant IL-20Rβ protein is produced to study its structure, function, and interactions with ligands. Understanding the signaling pathways and biological roles of IL-20Rβ can provide insights into its involvement in skin pathologies and may lead to novel treatment strategies. Furthermore, characterizing this receptor can shed light on the broader implications of IL-20 cytokines in immune regulation and chronic inflammatory diseases. The development and utilization of IL-20Rβ recombinant proteins in research facilitate the exploration of its therapeutic potential and contribute to the advancement of targeted therapies in dermatology and immunology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US