Analytical Data
-
Gene name
IL-21R
-
简介
The IL-21R protein is specifically designed for IL-21 and forms a heterodimeric complex with the common γ subunit, which is critical for signal transduction. This receptor complex promotes interaction with Janus kinase 1 (JAK1), initiating downstream signaling events in response to interleukin-21. IL-21R Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-21R protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Interleukin-21 receptor; IL-21 receptor; IL-21R; CD360; Nilr
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9JHX3
-
Expression Region
C20-P236
-
AA Sequence
CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDP
-
Protein Length
Extracellular Domain
-
Molecular Weight
34-38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IL-21R (Interleukin-21 receptor) is a crucial component of the immune system, playing a significant role in regulating immune responses, particularly in T and B cell functions. Its interaction with IL-21, a cytokine primarily produced by activated CD4+ T cells, initiates a cascade of signaling pathways that influence cell proliferation, differentiation, and survival. Given its essential role in mediating various immune responses, including those associated with autoimmunity, cancer, and infectious diseases, understanding IL-21R's structure and function has gained immense importance. Researchers have focused on producing recombinant IL-21R to study its biological properties, signaling mechanisms, and potential therapeutic applications. Recombinant IL-21R can serve as a valuable tool in developing targeted therapies for diseases characterized by immune dysregulation. By elucidating its interaction with IL-21 and downstream signaling pathways, scientists aim to uncover novel strategies for modulating immune responses, which could lead to advancements in treatments for conditions like lymphoma, autoimmune disorders, and chronic infections. The exploration of IL-21R through recombinant protein technologies thus holds promise for advancing our understanding of immunology and improving therapeutic interventions.











