Cat: IPD-X31651

Recombinant Mouse Chymase/CMA1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Chymase/CMA1

  • 简介

    Chymase/CMA1 Protein, a prominent secreted protease in mast cells, is implicated in various physiological processes, including the generation of vasoactive peptides, extracellular matrix degradation, and the regulation of gland secretion.Chymase/CMA1 Protein, Mouse (His) is the recombinant mouse-derived Chymase/CMA1 protein, expressed by E.coli , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Alpha-chymase; Mast cell chymase 1; Mast cell protease 5; mMCP-5; Mast cell protease I

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P21844

  • Expression Region

    I22-E246

  • AA Sequence

    IGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILREN

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    29.2kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Chymase, also known as CMA1 (Chymase 1), is a serine protease primarily expressed in mast cells and plays a crucial role in various physiological and pathological processes, including inflammation, tissue remodeling, and cardiovascular diseases. Its ability to cleave a wide range of substrates, such as peptide hormones, extracellular matrix proteins, and cytokines, underscores its significance in modulating immune responses and contributing to tissue homeostasis. Research on Chymase/CMA1 has gained traction due to its potential implications in several diseases, including asthma, atherosclerosis, and other allergic inflammatory conditions. Furthermore, the therapeutic targeting of Chymase has been explored as a promising strategy for managing these conditions. The development of recombinant Chymase/CMA1 proteins serves as a pivotal tool for understanding their biological functions and investigating their roles in disease mechanisms. These recombinant proteins facilitate enhanced studies in enzymatic activity, substrate specificity, and interaction with inhibitors, providing insights into their therapeutic potentials. Recent advances in recombinant DNA technology enable the production of high-yield, active Chymase proteins, paving the way for detailed structural and functional analyses. Consequently, the ongoing research aims to elucidate the multifaceted roles of Chymase/CMA1 in health and disease, ultimately striving to harness these insights for the development of novel therapeutic approaches targeting mast cell-derived chymase, which may offer new avenues for treating a variety of mast cell-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US