Cat: IPD-X23706

Recombinant Human PAP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PAP

  • 简介

    PAP proteins play a dual regulatory role in cell growth, exhibiting different effects depending on the specific growth factors involved. In fibroblasts, it exerts a positive regulatory effect by enhancing PDGFA-stimulated cell growth. PAP Protein, Human (His) is the recombinant human-derived PAP protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    28 kDa Heat- and Acid-Stable Phosphoprotein; PDGF-Associated Protein; PAP; PDGFA-Associated Protein 1; PAP1; PDAP1; HASPP28

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q13442

  • Expression Region

    M1-K181

  • AA Sequence

    MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK

  • Protein Length

    Full Length

  • Molecular Weight

    30.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on PAP (Pseudomonas aeruginosa Protein) recombinant proteins has gained significant attention due to their potential applications in biotechnology and medicine. Pseudomonas aeruginosa, a versatile and opportunistic pathogen, poses severe health risks, particularly in immunocompromised individuals, due to its ability to develop resistance to multiple antibiotics. Understanding the structure and function of PAP and its related proteins can provide insights into the mechanisms of bacterial virulence, helping to identify novel therapeutic targets. Recombinant technology enables the production of these proteins in larger quantities and with higher purity, facilitating the development of diagnostic tools and vaccines. Moreover, studying the immune response elicited by PAP recombinant proteins could lead to innovative strategies for infection control and prevention. The exploration of PAP and its derivatives is critical not only for understanding Pseudomonas aeruginosa pathogenicity but also for advancing the field of infectious diseases and improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US