Recombinant Human PAP Protein，His

PAP

PAP proteins play a dual regulatory role in cell growth, exhibiting different effects depending on the specific growth factors involved. In fibroblasts, it exerts a positive regulatory effect by enhancing PDGFA-stimulated cell growth. PAP Protein, Human (His) is the recombinant human-derived PAP protein, expressed by E. coli , with N-6*His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

28 kDa Heat- and Acid-Stable Phosphoprotein; PDGF-Associated Protein; PAP; PDGFA-Associated Protein 1; PAP1; PDAP1; HASPP28

Human

E. coli

N-6*His

Greater than 95% as determined by SDS-PAGE.

Q13442

M1-K181

MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK

Full Length

30.0 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.