Analytical Data
-
Gene name
Apolipoprotein A-I/APOA1
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human APOA1 at 5 µg/mL (100 µL/well) can bind Biotinylated Human MSR (HY-P76781). The ED50 for this effect is 0.5135 μg/mL. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human APOA1 at 5 µg/mL (100 µL/well) can bind Biotinylated Human MSR (HY-P76781). The ED50 for this effect is 0.5135 μg/mL.
-
Alternative Names
rHuApolipoprotein A-I; ApoA1; Apolipoprotein A-I
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02647
-
Expression Region
R19-Q267
-
AA Sequence
RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
25-27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Apolipoprotein A-I (APOA1) is a critical protein component of high-density lipoprotein (HDL) and plays a vital role in lipid metabolism and cardiovascular health. It is primarily synthesized in the liver and intestines and is essential for the reverse transport of cholesterol, which helps to prevent atherosclerosis and other cardiovascular diseases. Research into recombinant APOA1 proteins has gained significant attention due to their potential therapeutic applications, including the treatment of metabolic disorders and heart diseases. These recombinant proteins can be produced efficiently using various expression systems, enabling researchers to study their structure, function, and interactions with lipids and receptors. Additionally, recombinant APOA1 has been investigated for its role in enhancing the clearance of excess cholesterol and improving the lipid profiles in patients with dyslipidemia. Ongoing studies focus on the application of APOA1-based therapies in clinical settings, exploring their efficacy in promoting cardiovascular health and potentially serving as biomarkers for assessing cardiovascular risks. Overall, the investigation of recombinant APOA1 opens new avenues for understanding lipid metabolism and developing innovative strategies to combat cardiovascular diseases.











