Analytical Data
-
Gene name
BMPG
- Application
-
Alternative Names
rHuBMPG, His; Bone Marrow Proteoglycan; BMPG;
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
AAH05929.1
-
Expression Region
L17-Y222
-
AA Sequence
LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSYHHHHHH
-
Protein Length
Partial
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Bone Morphogenetic Protein-Growth Factor (BMPG) is a critical component in the field of regenerative medicine and tissue engineering, with significant implications for bone repair and development. Research into BMPG has gained momentum due to its pivotal role in osteogenesis, the process through which new bone is formed. BMPs, initially discovered in the 1960s for their ability to induce bone formation, have since been shown to orchestrate a variety of cellular processes, including cell proliferation, differentiation, and apoptosis. The therapeutic potential of BMPG lies not only in its capacity to enhance bone healing and regeneration but also in its ability to modulate the activity of various cell types involved in these processes. However, the clinical application of BMPG has faced challenges, including limited availability and potential for adverse effects, necessitating the development of recombinant forms to optimize efficacy and safety. The production of recombinant BMPG through biotechnological means allows for improved control over dosing, delivery, and immunogenicity, making it a focal point for ongoing research. Recent studies have explored innovative delivery systems, such as scaffolds and hydrogels, to enhance the bioactivity of BMPG in vivo. The growing understanding of BMP signaling pathways and their interaction with other growth factors further underscores the complexity of BMPG function, pointing to a need for comprehensive studies that can elucidate mechanisms of action. Ultimately, the continued exploration of BMPG in various applications holds great promise for advancing orthopedic surgery, enhancing healing processes, and improving outcomes for patients with bone-related injuries and disorders.
