Cat: IPD-X31415

Recombinant Rhesus Macaque ADAM8 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ADAM8

  • 简介

    ADAM8 is a transmembrane glycoprotein containing metalloproteinase and disintegrin domains, belonging to the ADAMs family. It has proteolytic, cell adhesion, cell fusion, and cell signaling properties. It is involved in ectodomain shedding of membrane proteins and is associated with inflammation and neurodegeneration. ADAM8 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived ADAM8 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ADAM 8; ADAM metallopeptidase domain 8; CD156a; MS2

  • Species

    Rhesus Macaque

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    XP_002805919

  • Expression Region

    R21-P497

  • AA Sequence

    RPWARVERYEVVLPRRLPGPRVRRALPSHVGLYPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGHPDSAASLSTCAGLRGFFQVGSDLHLIEPLDEGGEGGRHAVYEAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPQPGGSLPSRETRYVELYVVADNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNRQDRFHVSPHPDVTLENLLAWQAQRLTQRHLQDNVQLITGVDFTGTTVGLARVSAMCSHGSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCHCREPTEAGRCIMAGSIGSTFPRMFSDCSRAYLEGFLEQPQSACLANAPDLSHLVGGPVCGNLFVERGEQCDCGPPEDCRNHCCNSTTCQLAEGAQCAHGTCCQECRVKPAGELCRPKKDTCDLEEFCDGRHPECPEDAFQENGTP

  • Protein Length

    Partial

  • Molecular Weight

    55-60kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ADAM8, a member of the ADAM (A Disintegrin and Metalloproteinase) family, is a type I transmembrane protein characterized by its structure that includes a pro-domain, a metalloproteinase domain, a disintegrin domain, a cysteine-rich domain, and an epidermal growth factor-like domain. Research has highlighted ADAM8's significant role in various biological processes, including cell adhesion, migration, and signaling, particularly in the context of inflammation, cancer progression, and tissue remodeling. Elevated levels of ADAM8 have been associated with several pathological conditions, such as asthma, rheumatoid arthritis, and tumors, where it contributes to the cleavage of various substrates, affecting the tumor microenvironment and immune responses. The ability of ADAM8 to modulate these processes makes it a potential therapeutic target, warranting its recombinant protein production for studying its function and the underlying mechanisms involved. By utilizing recombinant DNA technology, researchers aim to produce ADAM8 in a controlled environment, enabling detailed analysis of its enzymatic activity, binding capabilities, and its interactions with other cellular components. This research not only elucidates the role of ADAM8 in health and disease but also paves the way for developing targeted inhibitors that could provide novel treatment options for ADAM8-related disorders. Understanding the structure-function relationship of ADAM8 through recombinant studies may lead to significant advancements in medical research, particularly in the fields of oncology and immunology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US