Cat: IPD-X23594

Recombinant Mouse WIF-1 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    WIF-1

  • 简介

    WIF-1 protein critically binds to WNT protein, inhibits its activity and regulates the WNT signaling pathway.In addition to its inhibitory role, WIF-1 may also contribute to mesoderm segmentation, implicating its role in embryonic development.WIF-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived WIF-1 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Wnt inhibitory factor 1; WIF-1

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9WUA1

  • Expression Region

    M1-W379

  • AA Sequence

    MARRRAFPAFALRLWSILPCLLLLRADAGQPPEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILRTPQNAIFFKTCQQAECPGGCRNGGFCNERRVCECPDGFYGPHCEKALCIPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCELSKCPQPCRNGGKCIGKSKCKCPKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCREGWHGRHCNKRYGASLMHAPRPAGAGLERHTPSLKKAEDRRDPPESNYIW

  • Protein Length

    Full Length

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

WIF-1 (Wnt Inhibitory Factor-1) is a secreted protein that plays a critical role in the regulation of the Wnt signaling pathway, which is essential for various developmental processes and cell proliferation. Abnormal activation of Wnt signaling is associated with multiple cancers, making WIF-1 an important molecule for potential therapeutic applications. Research has highlighted that WIF-1 can antagonize Wnt signaling by binding to Wnt ligands, thereby preventing their interaction with Frizzled receptors. Understanding the structure and function of WIF-1 has significant implications for targeted cancer therapies and regenerative medicine, as it may provide insights into mechanisms of tumor suppression and tissue repair. Recent studies have focused on the recombinant expression of WIF-1 to establish its functional characteristics and properties. This involves leveraging advanced molecular biology techniques to produce WIF-1 in host systems, allowing for detailed biochemical analyses and the exploration of its therapeutic potential. Ongoing research also aims to elucidate the role of WIF-1 in various biological contexts, including its implications in embryonic development and tissue homeostasis. As a candidate for biomarker development and a target for therapeutic intervention, WIF-1 continues to be an area of intense study, with the hope of translating these findings into clinical applications for cancer treatment and regenerative medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US