Analytical Data
-
Gene name
ASB13
- Application
-
Alternative Names
rHuSB13, His; Ankyrin repeat and SOCS box protein 13; ASB13; SB13
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WXK3-1
-
Expression Region
M1-N278
-
AA Sequence
HHHHHHMEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ASB13 (Ankyrin repeat and SOCS box-containing protein 13) is a member of the ASB family of proteins, which are characterized by the presence of ankyrin repeat motifs and a SOCS box domain. These features suggest potential roles in protein-protein interactions and involvement in signaling pathways related to cellular growth, immunity, and apoptosis. The study of ASB13 has gained attention due to its possible implications in various diseases, including cancer and immune disorders. By modulating key signaling pathways, ASB13 may influence the stability and degradation of target proteins through the ubiquitin-proteasome system. Research has indicated that ASB13 may play a critical role in the regulation of inflammatory responses, given its interaction with cytokine signaling pathways. Furthermore, understanding the molecular mechanisms behind ASB13's function could provide insights into therapeutic strategies for diseases where these pathways are dysregulated. As such, the generation and characterization of recombinant ASB13 protein are of paramount importance to elucidate its biological functions and potential as a drug target. Current studies aim to investigate ASB13's structure, interaction partners, and specific roles in cellular processes, which may lead to broader implications in health and disease management.
