Analytical Data
-
Gene name
GOLM1
-
简介
GOLM1 Protein, amid partial comprehension, acts as a cellular response protein to viral infections, with an intricate role yet to be fully understood. Interactions with DYM suggest potential links to cellular dynamics or host-virus interactions. Further investigation is crucial to delineate GOLM1's specific contributions and implications in cellular defense mechanisms against viral infections. GOLM1 Protein, Human (His) is the recombinant human-derived GOLM1 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NBJ4-1
-
Expression Region
S36-L401
-
AA Sequence
SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
-
Protein Length
Lumenal Domain
-
Molecular Weight
46 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GOLM1, also known as Golgi membrane protein 1, is a type II membrane protein primarily localized in the Golgi apparatus, an essential organelle involved in protein sorting, modification, and trafficking. Recent studies have highlighted its significance in various biological processes, including cell proliferation, differentiation, and the maintenance of cellular homeostasis. GOLM1 has emerged as a biomarker of interest in cancer research, particularly in hepatocellular carcinoma (HCC), where its expression levels are often correlated with tumor progression and poor prognosis. The unique expression profile of GOLM1 in certain cancer types, as opposed to normal tissues, makes it a potential target for diagnosis and therapy. As researchers aim to understand the molecular mechanisms underlying its function, the development of GOLM1 recombinant proteins has become essential. These recombinant proteins facilitate the study of GOLM1's role in cellular processes and its interaction with other molecules, thereby providing insights into its potential therapeutic applications. Furthermore, understanding GOLM1's structure and function may pave the way for novel cancer treatments aimed at inhibiting tumor growth and improving patient outcomes. Overall, GOLM1 represents a promising area of research that bridges the gap between basic biology and clinical applications in oncology.
