Cat: IPD-X23448

Recombinant Human Apolipoprotein A-I/APOA1 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Apolipoprotein A-I/APOA1

  • 简介

    Apolipoprotein A-I Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein A-I (ApoA-I), the major protein component in high-density lipoprotein (HDL), plays key roles in the Reverse Cholesterol Transport pathway. Apolipoprotein A-I is associated with dengue virus (DV) particles and enhances virus infection through SR-BI[1][2][3].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Apolipoprotein A-I/ApoA1 at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human SR-AI/MSR. The ED50 for this effect is <1.2 µg/mL. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Apolipoprotein A-I/ApoA1 at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human SR-AI/MSR.The ED50 for this effect is 1.196 µg/mL.

  • Alternative Names

    rHuApolipoprotein A-I, His; ApoA1; Apolipoprotein A-I

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P02647

  • Expression Region

    R19-Q267

  • AA Sequence

    RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQHHHHHH

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    32.22 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Apolipoprotein A-I (APOA1) is a critical protein component of high-density lipoprotein (HDL) and plays a vital role in lipid metabolism and cardiovascular health. It is primarily synthesized in the liver and intestines and is essential for the reverse transport of cholesterol, which helps to prevent atherosclerosis and other cardiovascular diseases. Research into recombinant APOA1 proteins has gained significant attention due to their potential therapeutic applications, including the treatment of metabolic disorders and heart diseases. These recombinant proteins can be produced efficiently using various expression systems, enabling researchers to study their structure, function, and interactions with lipids and receptors. Additionally, recombinant APOA1 has been investigated for its role in enhancing the clearance of excess cholesterol and improving the lipid profiles in patients with dyslipidemia. Ongoing studies focus on the application of APOA1-based therapies in clinical settings, exploring their efficacy in promoting cardiovascular health and potentially serving as biomarkers for assessing cardiovascular risks. Overall, the investigation of recombinant APOA1 opens new avenues for understanding lipid metabolism and developing innovative strategies to combat cardiovascular diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US