Recombinant Human HMGB1/HMG-1 Protein (HEK293)，His

HMGB1/HMG-1

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (HEK293, His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by HEK293 , with C-6*His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured by its binding ability in a functional ELISA.Immobilized Recombinant Human HMGB1/HMG-1 at 2 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human AGER/RAGE Protein. The ED50 for this effect is 77.15 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human HMGB1/HMG-1 at 2 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human AGER / RAGE Protein. The ED50 for this effect is 77.15 ng/mL.

rHuHigh mobility group protein B1/HMGB1, His; High Mobility Group Protein B1; High Mobility Group Protein 1; HMG-1; HMGB1; HMG1

Human

HEK293

C-6*His

Greater than 95% as determined by SDS-PAGE.

P09429

G2-E215

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Partial

24-33 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.