Cat: IPD-X23208

Recombinant Human ULBP3 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ULBP3

  • 简介

    The ULBP3 protein plays a key role in natural killer cell cytotoxicity and activates the KLRK1/NKG2D receptor. The interaction of ULBP3 highlights its importance in mediating cytotoxic responses. ULBP3 Protein, Human (HEK293, His) is the recombinant human-derived ULBP3 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA.When Recombinant Human NKG2D/CD314 (HY-P70688) is immobilized at 2 μg/mL (100 μL/well) can bind Recombinant Human ULBP-3. The ED50 for this effect is 1.127 μg/mL. Measured by its binding ability in a functional ELISA.When Recombinant Human NKG2D/CD314 (HY-P70688) is immobilized at 2 μg/mL (100 μL/well) can bind Recombinant Human ULBP-3. The ED50 for this effect is 1.127 μg/mL.

  • Alternative Names

    NKG2D ligand 3; RAET1N; UL16 binding protein 3; ULBP3; ULBP-3

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q9BZM4

  • Expression Region

    D30-P216

  • AA Sequence

    DAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTAPPTMAP

  • Protein Length

    Partial

  • Molecular Weight

    25-31 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HMGB1 (High Mobility Group Box 1) is a non-histone chromatin-binding protein that plays a critical role in various cellular processes, including DNA repair, gene expression regulation, and inflammation modulation. As a key player in the immune response, HMGB1 acts as a damage-associated molecular pattern (DAMP), signaling stress and tissue injury, and facilitating the activation of innate immunity. Elevated levels of HMGB1 have been linked to numerous pathological conditions, including autoimmune diseases, cancer, and sepsis, highlighting its potential as a therapeutic target. The recombinant form of HMGB1, often referred to as HMG-1, has been developed for extensive research into its biological functions and mechanisms. By producing HMG-1 through recombinant DNA technology, researchers can dissect its interactions with various cellular partners, elucidate its signaling pathways, and evaluate its therapeutic implications in controlling inflammation and promoting tissue repair. The use of recombinant HMGB1 has also enabled the exploration of its role in modulating immune responses, providing insights into its potential use as a biomarker for disease diagnosis and prognosis. Overall, the study of HMGB1/HMG-1 recombinant protein continues to be a fertile ground for understanding its multifaceted roles in health and disease, paving the way for innovative therapeutic approaches.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US