Cat: IPD-X27677

Recombinant Human ZNF70 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ZNF70

  • 简介

    The ZNF70 protein itself is a potential regulator of transcriptional processes, suggesting that it may play a role in shaping cellular function through gene expression control. Although the specific mechanisms and target genes affected by ZNF70 are not fully understood, its versatility in transcriptional regulation implies potential effects on a variety of cellular pathways. ZNF70 Protein, Human (His) is the recombinant human-derived ZNF70 protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Zinc Finger Protein 70; Zinc Finger Protein N27C7-1; ZNF70

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UC06

  • Expression Region

    M1-L446

  • AA Sequence

    MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL

  • Protein Length

    Full Length

  • Molecular Weight

    60 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The ZNF70 gene encodes a member of the zinc finger protein family, which plays a crucial role in various biological processes, including transcription regulation, DNA binding, and cellular signal transduction. Research into ZNF70 has gained momentum due to its potential implications in cancer biology, cell differentiation, and immune responses. Abnormal expression or mutations in the ZNF70 gene have been associated with various malignancies, indicating its role as a possible oncogene or tumor suppressor. Additionally, the distinctive structural features of ZNF70, characterized by multiple zinc finger motifs, facilitate its interaction with specific DNA sequences, highlighting its importance in gene regulation. The generation of recombinant ZNF70 protein is essential for elucidating its functional mechanisms and exploring its biological relevance. Scientists aim to produce ZNF70 as a recombinant protein to study its binding affinities, functional interactions, and cellular pathways it influences. By understanding the molecular underpinnings associated with ZNF70, researchers hope to uncover potential therapeutic targets for diseases linked to its dysregulation, paving the way for novel strategies in cancer treatment and regenerative medicine. Overall, the study of ZNF70 and its recombinant protein provides valuable insights into the complexity of gene regulation and its impact on human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US