Analytical Data
-
Gene name
Apolipoprotein E/APOE
-
简介
Apolipoprotein E/APOE is crucial in lipid transport and participates in the production, transformation and clearance of plasma lipoproteins. It interacts with various particles, including chylomicrons and high-density lipoproteins, and binds to cellular receptors such as LDLR and VLDLR, promoting uptake. Apolipoprotein E/APOE Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Apolipoprotein E/APOE protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Alternative Names
Apolipoprotein E; Apo-E; APOE; apolipo E
-
Species
Mouse
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08226
-
Expression Region
E19-Q311
-
AA Sequence
EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
62-66 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Apolipoprotein E (APOE) is a crucial protein involved in lipid metabolism and is primarily produced by the liver and brain tissue. It plays a significant role in the transport and clearance of lipoproteins and cholesterol in the bloodstream, thus influencing a range of physiological processes. The APOE gene has three major alleles: ε2, ε3, and ε4, with the ε4 variant being strongly associated with an increased risk of Alzheimer's disease and cognitive decline. Given the implications of APOE in neurodegenerative conditions, researchers have been increasingly focused on the recombinant production of APOE proteins for studying their structure-function relationships and therapeutic potential. Recombinant APOE proteins enable detailed investigations into their roles in neuronal health, lipid binding, and interactions with receptors. These studies are pivotal for understanding the pathogenic mechanisms of diseases, developing potential treatments, and exploring biomarkers for early detection of disorders linked to APOE. Additionally, recombinant APOE can be utilized in drug delivery systems and as a target for designing novel therapeutic interventions, making it a significant focus in biomedical research and pharmacology.
