Analytical Data
-
Gene name
IgG-binding A
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Protein A at 2 μg/mL (100μL/well) can bind Biotinylated IgG1. The ED50 for this effect is 0.1293 μg/mL. Measured by its binding ability in a functional ELISA. Immobilized Protein A at 2 μg/mL (100 μL/well) can bind Biotinylated IgG1. The ED50 for this effect is 0.1293 μg/mL.
-
Alternative Names
Immunoglobulin G-binding protein A
-
Species
Staphylococcus aureus
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P02976
-
Expression Region
N35-D330
-
AA Sequence
NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEED
-
Protein Length
Partial
-
Molecular Weight
32-35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of IgG-binding recombinant proteins has gained significant attention due to their fundamental role in immune responses and potential therapeutic applications. Immunoglobulin G (IgG) is a crucial antibody class in the adaptive immune system, responsible for neutralizing pathogens and modulating immune activities. The ability of certain proteins to bind to IgG can be harnessed for various purposes, such as the development of diagnostic tools, therapeutic agents, and targeted drug delivery systems. For instance, recombinant proteins that mimic IgG-binding domains can help in the purification of antibodies or in the creation of biosensors for disease detection. Moreover, understanding the structural and functional characteristics of these proteins can unveil novel mechanisms of immune evasion by pathogens, paving the way for innovative vaccine strategies. Recent advances in biotechnology and protein engineering have streamlined the production of these recombinant proteins, enhancing their availability for research and clinical applications. As a result, the exploration of IgG-binding recombinant proteins continues to be a rapidly evolving field, promising valuable insights into immunity and opening new avenues for medical intervention.
