Cat: IPD-X30996

Recombinant Human KRAS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KRAS

  • 简介

    KRAS protein is a key Ras family member that binds GDP/GTP and has intrinsic GTPase activity. Its critical role in regulating cell proliferation emphasizes its importance in cellular processes. KRAS Protein, Human (G12S, His) is the recombinant human-derived KRAS, expressed by E. coli, with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuKRAS-G12S, His; Ki-Ras; c-K-ras; KRAS2; RASK2; CFC2

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    AAH13572.1

  • Expression Region

    T2-C185, G12S

  • AA Sequence

    TEYKLVVVGASGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

  • Protein Length

    Partial

  • Molecular Weight

    25-30 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KRAS is a prominent member of the RAS gene family, which encodes proteins that act as molecular switches in various cellular processes, including growth, differentiation, and survival. Mutations in the KRAS gene are commonly associated with several types of cancers, particularly pancreatic, colorectal, and lung cancers, making it a critical target for cancer research. The most frequent mutations occur at codons 12, 13, and 61, leading to constitutive activation of KRAS and driving tumorigenesis through aberrant signaling pathways such as the MAPK and PI3K pathways. Due to its central role in oncogenic signaling, KRAS has been a challenging target for drug development, historically considered "undruggable." However, advances in biotechnology and pharmacology have led to the emergence of novel therapeutic strategies aimed at inhibiting mutant KRAS or its downstream effectors. The study of recombinant KRAS proteins, which involves the production of these proteins in vitro using expression systems, has become a pivotal approach to understand the molecular mechanisms of KRAS activation and its interactions with potential inhibitors. Such research not only aids in elucidating the functional impact of specific mutations but also supports the identification and validation of promising drug candidates. Ongoing investigations into KRAS-targeted therapies continue to hold significant promise for improving treatment outcomes in KRAS-mutant cancers, emphasizing the importance of continued research in this area.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US