Analytical Data
-
Gene name
Dectin-1/CLEC7A
-
简介
The Dectin-1/CLEC7A protein is a lectin and pattern recognition receptor that targets β-1,3- and β-1,6-linked glucans in bacterial and fungal cell walls. It triggers Toll-like receptor 2 (TLR2)-mediated inflammation by recruiting splenic tyrosine kinase (SYK) and activating the CARD domain-BCL10-MALT1 (CBM) signalosome. Dectin-1/CLEC7A Protein, Human (HEK293, Fc) is the recombinant human-derived Dectin-1/CLEC7A protein, expressed by HEK293 , with N-hFc labeled tag.
- Application
-
Alternative Names
rHuC-type lectin domain family 7 member A/Dectin-1, Fc; Beta-glucan receptor; BGR; CD369; CLEC7A; CLECSF12; CLECSF12DC-associated C-type lectin 1; Dectin1; Dectin-1; DECTIN1CANDF4
-
Species
Human
-
Source
HEK293
-
Tag
N-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BXN2-1
-
Expression Region
T66-M247
-
AA Sequence
TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM
-
Protein Length
Extracellular Domain
-
Molecular Weight
50-65 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Dectin-1, also known as CLEC7A, is a C-type lectin receptor primarily expressed on innate immune cells, such as macrophages and dendritic cells. It plays a crucial role in the recognition and phagocytosis of fungal pathogens, particularly by binding to β-glucans, which are polysaccharides found in fungal cell walls. Research has shown that Dectin-1 activation initiates downstream signaling pathways that enhance immune responses, leading to the production of pro-inflammatory cytokines and the promotion of Th17 cell differentiation. This receptor is also implicated in autoimmune diseases and allergies, making it a significant target for therapeutic interventions. Recombinant Dectin-1/CLEC7A protein is produced to study its structure, function, and therapeutic potential. By understanding the mechanisms through which Dectin-1 modulates the immune response, researchers aim to develop novel strategies for treating fungal infections, enhancing vaccine efficacy, and managing autoimmune conditions. The recombinant protein serves as a valuable tool for elucidating Dectin-1's role in immune signaling and its implications in health and disease.











