Analytical Data
-
Gene name
SPARC
-
简介
SPARC protein is involved in the regulation of cell growth and may play a regulatory role by affecting the interaction of extracellular matrix and cytokines. SPRC protein can bind calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. It has two calcium binding sites: one is an acidic domain that can bind 5-8 Ca2+ with low affinity, and the other is an EF-hand loop that can bind Ca2+ ions with high affinity. SPARC Protein, Rat (HEK293, His) is the recombinant rat-derived SPARC protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its ability to inhibit the cell growth of Mv-1-Lu mink lung epithelial cells. The ED50 for this effect is typically 3.581μg/mL, corresponding to a specific activity is 2.793×102 U/mg. Measured by its ability to inhibit the cell growth of Mv-1-Lu mink lung epithelial cells. The ED50 for this effect is typically 3.581 μg/mL, corresponding to a specific activity is 2.793×102 U/mg.
-
Alternative Names
SPARC; BM-40; Osteonectin; ON; Secreted Protein Acidic and Rich in Cysteine
-
Species
Rat
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16975
-
Expression Region
A18-I301
-
AA Sequence
APQTEAAEEMVAEETVVEETGLPVGANPVQVEMGEFEEGAEETVEEVVAENPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
33.8-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPARC (Secreted Protein Acidic and Rich in Cysteine) is a hallmark matricellular protein that plays pivotal roles in cellular functions such as adhesion, proliferation, and differentiation. Initially identified in bone tissue, SPARC is now recognized as a crucial component in various biological processes, including wound healing, angiogenesis, and tumor biology. Its expression levels have been correlated with several pathologies, notably cancer, where it can influence tumor growth and metastasis. Researchers have focused on SPARC as a potential therapeutic target due to its ability to modulate the tumor microenvironment and ECM interactions. The study of SPARC recombinant proteins has enabled deeper investigations into its functional mechanisms and interactions with other cellular components. These recombinant proteins provide researchers with tools to explore SPARC's role in different contexts by allowing for controlled experiments that elucidate its behavior in the extracellular matrix. Furthermore, the development of SPARC-based biomaterials has shown promise in tissue engineering and regenerative medicine. Overall, the research surrounding SPARC recombinant proteins highlights their significance in understanding complex biological processes and their potential applications in developing novel therapeutic strategies.











