Cat: IPD-X19340

Recombinant Human IL-6R alpha Protein(HEK293), Avi & His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-6R alpha

  • 简介

    IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha/CD126, Human consists of 468 amino acids (M1-R468) with two fibronectin type-III-like domains contained in the N-terminal part (113-217 a.a, 218-316 a.a), and a soluble form (1-365 a.a). Soluble IL-6R (sIL-6R) binds IL-6 and dimerized gp130 to achieve trans signaling, and exhibits a tissue expression property in some immune systems. IL-6R alpha Protein, Human (L20-P365) is soluble and biotinylated recombinant protein expressed by HEK293 cells with a C-Terminal Avi-tag and a C-Terminal His-tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Interleukin-6 receptor subunit alpha; IL-6R subunit alpha; IL-6R-alpha; IL-6R 1; Membrane glycoprotein 80; gp80; CD126

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-Avi;C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P08887-1

  • Expression Region

    L20-P365

  • AA Sequence

    LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    65-85 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-6 receptor alpha (IL-6Rα) is a crucial component of the interleukin-6 (IL-6) signaling pathway, which plays a significant role in immune response, inflammation, and hematopoiesis. Dysregulation of IL-6 and its receptor is linked to various disease conditions, including autoimmune disorders, chronic inflammatory diseases, and certain types of cancer. The study of IL-6Rα, particularly the development and application of recombinant proteins, has garnered attention in both therapeutic and diagnostic contexts. Recombinant IL-6Rα proteins can be utilized to better understand the functional mechanisms of IL-6 signaling and to explore potential therapeutic interventions. For example, monoclonal antibodies targeting IL-6Rα, such as tocilizumab, have shown promise in treating diseases like rheumatoid arthritis and cytokine release syndrome. Moreover, the investigation of IL-6Rα's role in signaling cascades contributes to the understanding of its involvement in various pathological conditions, potentially leading to the identification of new therapeutic targets. Recent advancements in recombinant protein technology have enabled the generation of high-quality IL-6Rα proteins, facilitating detailed studies on its structure, function, and interactions with other signaling molecules. Thus, research on IL-6Rα recombinant proteins is pivotal for elucidating the complexities of IL-6-related pathways and developing innovative strategies to combat related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US