Recombinant Human IL-6R alpha Protein(HEK293), His

IL-6R alpha

IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha/CD126, Human consists of 468 amino acids (M1-R468) with two fibronectin type-III-like domains contained in the N-terminal part (113-217 a.a, 218-316 a.a), and a soluble form (1-365 a.a). Soluble IL-6R (sIL-6R) binds IL-6 and dimerized gp130 to achieve trans signaling, and exhibits a tissue expression property in some immune systems.IL-6R alpha Protein, Human (HEK293, His) is soluble form and produced in HEK293 cells with a C-Terminal His-tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured by its binding ability in a functional ELISA. When Recombinant Human IL-6 protein is represent at 1 µg/mL (100 µL/mL) can bind Recombinant Human IL-6R alpha. The ED50 for this effect is 1.038 μg/mL. Measured by its binding ability in a functional ELISA. When Recombinant Human IL-6 protein is represent at 1 µg/mL (100 µL/mL) can bind Recombinant Human IL-6R alpha. The ED50 for this effect is 1.038 μg/mL.

Interleukin-6 receptor subunit alpha; IL-6R subunit alpha; IL-6R-alpha; IL-6R 1; Membrane glycoprotein 80; gp80; CD126

Human

HEK293

C-6*His

Greater than 90% as determined by SDS-PAGE.

P08887-1

L20-D358

LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD

Partial

58-75 kDa.

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.