Analytical Data
-
Gene name
FGL1
-
简介
FGL1 Protein, a potent immune suppressive molecule, inhibits antigen-specific T-cell activation as a major ligand for LAG3. It crucially contributes to LAG3-mediated T-cell inhibitory functions, independently of MHC class II. Secreted by hepatocytes, FGL1 also promotes their growth. The homodimeric form of the protein interacts with LAG3, specifically engaging with its Ig-like domains 1 and 2 through the Fibrinogen C-terminal domain. FGL1 Protein, Cynomolgus (HEK293, mFc) is the recombinant cynomolgus-derived FGL1 protein, expressed by HEK293 , with N-mFc labeled tag.
- Application
-
Biological Activity
Immobilized Biotinylated Human LAG-3 Fc-Avi at 1 μg/mL (100 μL/well) on Streptavidin precoated (0.5 μg/well) plate can bind Cynomolgus / Rhesus macaque FGL1 mFc with a linear range of 0.019-0.625 μg/mL. Immobilized Mouse LAG-3, His Tag at 5 μg/mL (100 μL/well) can bind Mouse FGL1. The ED50 for this effect is 0.5343 μg/mL.
-
Alternative Names
FGL1; Hepassocin; HP-041; HFREP-1; LFIRE-1; HFREP1
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
N-mFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
G7N0K6
-
Expression Region
L23-I312
-
AA Sequence
LEDCAQEQVRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGEENSVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFAVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGSFHPEVQWWATHQRMKFSTWDRDHDNYDGNCAEEDQSGWWFNRCHSANLNGLYYTGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
60-66 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FGL1, or Fibrinogen-like protein 1, is a member of the fibrinogen-related protein family that plays a crucial role in various biological processes, including immunoregulation, inflammation, and tumor progression. It has garnered significant attention in recent years due to its dual function in modulating both immune responses and tumor microenvironments. Elevated FGL1 expression has been correlated with poor prognosis in several types of cancer, suggesting its potential as a biomarker for disease progression and a target for therapeutic intervention. Research has shown that FGL1 can inhibit T cell activation and promote immune evasion by tumors, highlighting its role in the suppression of anti-tumor immunity. Moreover, FGL1 has been implicated in facilitating tumor growth and metastatic spread. Consequently, the development of FGL1 recombinant proteins aims to elucidate its mechanisms of action, assess its functional characteristics, and explore its potential in clinical applications, particularly in oncology and immunotherapy. By gaining a deeper understanding of FGL1's role in immune modulation and tumor dynamics, researchers hope to harness its properties for novel therapeutic strategies, enhancing the efficacy of existing treatments and improving patient outcomes. This background lays the foundation for ongoing studies focusing on FGL1's interactions within the immune system, its structural and functional properties, and the feasibility of targeting FGL1 in therapeutic contexts.
