Cat: IPD-X29926

Recombinant Mouse Carbonic Anhydrase 10 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Carbonic Anhydrase 10

  • 简介

    Carbonic Anhydrase 10 Protein, a member of the carbonic anhydrase family, plays a role in the regulation of pH and ion transport. It is expressed in various tissues, including the brain, liver, and kidney. The potential involvement of Carbonic Anhydrase 10 Protein in diseases and its physiological functions make it a subject of interest in biomedical research. Carbonic Anhydrase 10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carbonic Anhydrase 10 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Carbonic anhydrase-related protein 10; CA-RP X; Cerebral protein 15; CA10

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P61215

  • Expression Region

    M1-N300

  • AA Sequence

    MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTN

  • Protein Length

    Partial

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Carbonic Anhydrase 10 (CA10) is an important member of the carbonic anhydrase enzyme family, which catalyzes the reversible hydration of carbon dioxide to bicarbonate and protons, playing a crucial role in various physiological processes such as pH regulation, carbon dioxide transport, and ion homeostasis. Research indicates that CA10 may be involved in neurological functions, and alterations in its activity have been linked to conditions such as epilepsy and schizophrenia. Understanding the structure and function of CA10 is essential for elucidating its role in these disorders. Recent advances in recombinant protein technology have facilitated the production of CA10, enabling researchers to investigate its enzymatic properties and potential as a therapeutic target. Characterizing recombinant CA10 not only aids in unraveling its biochemical pathways but also contributes to the development of specific inhibitors that could pave the way for innovative treatments for related diseases. Thus, the study of recombinant CA10 is a promising area of research that bridges biochemistry and clinical application, offering insights into both fundamental biology and the potential for novel therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US