Analytical Data
-
Gene name
LILRA2/CD85h/ILT1
-
简介
The LILRA2/CD85h/ILT1 protein is critical in the innate immune response and recognizes N-terminally truncated immunoglobulins from a variety of pathogenic bacteria and fungi. It interacts with cleaved IgM, IgG3 and IgG4, triggering neutrophil and monocyte activation. LILRA2/CD85h/ILT1 Protein, Human (HEK293, His) is the recombinant human-derived LILRA2/CD85h/ILT1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 2; CD85 Antigen-Like Family Member H; Immunoglobulin-Like Transcript 1; ILT-1; Leukocyte Immunoglobulin-Like Receptor 7; LIR-7; CD85h; LILRA2; ILT1; LIR7
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N149-2
-
Expression Region
G24-S420
-
AA Sequence
GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSAS
-
Protein Length
Partial
-
Molecular Weight
66 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LILRA2, also known as CD85h or ILT1, is a member of the leukocyte immunoglobulin-like receptors (LILRs) family, which plays a crucial role in the immune system by modulating immune responses. This receptor is predominantly expressed in myeloid cells and has been implicated in various physiological and pathological processes, including immune regulation, inflammation, and tumor evasion. The study of LILRA2 is significant, as it may serve as a potential therapeutic target for enhancing anti-tumor immunity or mitigating autoimmune diseases. Recent research has focused on the structural characterization and functional analysis of LILRA2 to better understand its ligand interactions and signaling mechanisms. By developing recombinant LILRA2 proteins, scientists aim to explore its biological functions and potential applications in immunotherapy. Understanding the role of LILRA2 in immune modulation could pave the way for innovative strategies in treating malignancies and enhancing vaccine efficacy, as well as provide insights into the microbial environment’s interaction with immune responses. Thus, LILRA2/CD85h/ILT1 remains a critical focus of research within immunology, with implications for both basic science and clinical applications.











