Cat: IPD-X35953

Recombinant Human ILT6 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ILT6

  • 简介

    LILRA3/CD85e/ILT6 functions as a soluble receptor for class I MHC antigens, binding both classical and non-classical HLA class I molecules, albeit with lower affinities than LILRB1 or LILRB2. It engages with monocyte surfaces, effectively suppressing LPS-induced TNF-alpha production by monocytes. ILT6 Protein, Human (HEK293, His) is the recombinant human-derived ILT6 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N6C8-1

  • Expression Region

    T19-E439

  • AA Sequence

    THVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

  • Protein Length

    Partial

  • Molecular Weight

    60-90 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ILT6 (Inhibitory Ly-49-like Receptor 6) is a member of the ILT (Immunoglobulin-like Transcript) family, which plays a significant role in the regulation of immune responses. Researchers have focused on ILT6 due to its potential as an immunological checkpoint receptor, which can inhibit the activation of immune cells such as natural killer (NK) cells and T cells. The expression of ILT6 on certain immune and tumor cells suggests its involvement in immune evasion mechanisms, which is a common characteristic of tumors. Understanding the function and mechanisms of ILT6 can provide valuable insights into tumor microenvironments and the development of novel immunotherapeutic strategies. The study of ILT6 recombinant protein is particularly important as it allows for the investigation of its structure, binding properties, and functional characteristics in a controlled manner. This research could lead to the identification of potential therapeutic targets, enhancing the efficacy of existing treatments, and contributing to the development of new immunomodulatory therapies aimed at restoring anti-tumor immunity. Given the growing interest in harnessing the immune system to combat cancer, ILT6 represents a promising candidate for further exploration in the field of cancer immunotherapy.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US