Cat: IPD-X35904

Recombinant Human Siglec-15 Protein (HEK293),hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Siglec-15

  • 简介

    The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, Fc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Sialic acid-binding Ig-like lectin 15; Siglec-15; CD33 antigen-like 3; CD33L3

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6ZMC9-1

  • Expression Region

    F20-T263

  • AA Sequence

    FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    50-80 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Siglec-15, a member of the sialic acid-binding immunoglobulin-like lectins (Siglecs) family, has gained significant attention in immunology and cancer research due to its unique role in modulating immune responses. Discovered as a receptor predominantly expressed on myeloid cells, Siglec-15 is implicated in the regulation of macrophage function and T-cell activity. Its interaction with sialic acid, a common post-translational modification on glycoproteins, allows it to play a crucial role in immune evasion mechanisms employed by tumors. Research has highlighted that tumor cells often overexpress sialylated glycans, which can engage Siglec-15 and inhibit effector immune cell functions, leading to a suppressed immune response. Consequently, understanding the functional and structural characteristics of Siglec-15 is vital for developing therapeutic strategies aimed at enhancing anti-tumor immunity. Recent studies have focused on the potential of Siglec-15 as a target for immunotherapy, exploring its role as a checkpoint molecule. The generation of recombinant Siglec-15 proteins has provided valuable tools for investigating its biological functions, signaling pathways, and interactions with ligands. Such research endeavors not only deepen our understanding of immune regulation but also pave the way for innovative treatments in cancer therapy and other immune-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US