Analytical Data
-
Gene name
CD58
-
简介
CD58, a glycoprotein, is also known as lymphocyte-function antigen 3 (LFA-3). CD58 is a costimulatory receptor, and can interact with its natural ligand (CD2, primarily expressed on the surface of T/NK cells). The CD2-CD58 interaction can promote cell adhesion and recognition, and regulate antiviral responses, inflammatory responses in autoimmune diseases, immune rejection of transplantation, and immune evasion of tumor cells[1]. CD58 Protein, Human (HEK293, His) is the recombinant human-derived CD58 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Biological Activity
Measured in a cell proliferation assay using PHA-stimulated THP-1 human erythroleukemic cells. The ED50 for this effect is 0.4424 μg/mL,corresponding to a specific activity is 2.26×103 units/mg. Measured in a cell proliferation assay using PHA-stimulated THP-1 human erythroleukemic cells. The ED50 for this effect is 0.4424 μg/mL, corresponding to a specific activity is 2.26×103 units/mg.
-
Alternative Names
Lymphocyte Function-Associated Antigen 3; Surface Glycoprotein LFA-3; CD58; LFA3; Ag3; CD58 antigen
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
AAH05930
-
Expression Region
F29-R215
-
AA Sequence
FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
-
Protein Length
Partial
-
Molecular Weight
30-60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD58, also known as lymphocyte function-associated antigen 3 (LFA-3), is a cell surface protein that plays a critical role in the immune system by facilitating the interaction between antigen-presenting cells and T cells. Understanding CD58's structure and function is vital for developing targeted immunotherapies for various diseases, including cancers and autoimmune disorders. The recombinant form of CD58 has been utilized in various studies to elucidate its effects on T-cell activation and proliferation. Research indicates that CD58 enhances T-cell responses by binding to CD2, promoting stronger adhesion and signaling pathways necessary for effective immune responses. Recent investigations focus on the therapeutic potential of CD58 in enhancing the efficacy of existing immunotherapies, as well as its role in the tumor microenvironment where it may influence immune evasion mechanisms employed by cancer cells. The generation of CD58 recombinant protein allows for detailed studies into its mechanistic roles, interactions, and potential as a biomarker in clinical settings. This research could pave the way for novel treatments that harness the body's immune system more effectively, emphasizing the importance of CD58 in immune modulation.











