Analytical Data
-
Gene name
DNAM-1
-
简介
DNAM-1 Protein, a cell surface receptor, mediates intercellular adhesion, signaling, cytotoxicity, and lymphokine secretion in CTL and NK cells. It acts as a receptor for NECTIN2, stimulating T-cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG). DNAM-1 Protein competes with PVRIG for NECTIN2-binding and interacts with PVR and NECTIN2. DNAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DNAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
DNAX accessory molecule 1; DNAM-1; CD226 antigen; CD226
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8K4F0
-
Expression Region
E19-P254
-
AA Sequence
EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP
-
Protein Length
Extracellular Domain
-
Molecular Weight
35-50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DNAM-1 (DNAX accessory molecule-1) is a crucial costimulatory receptor primarily expressed on the surface of T cells and natural killer (NK) cells, playing a significant role in mediating immune responses against tumors and viral infections. Research on DNAM-1 is motivated by its potential to enhance the body's immune response, as it interacts with ligands such as PVR (Polioviruses receptor) and Nectin-2, facilitating the activation and proliferation of immune cells. In cancer immunotherapy, DNAM-1 has garnered attention due to its involvement in tumor recognition and the cytotoxic activity of NK cells. As tumors often exploit various immune evasion strategies, understanding the mechanisms of DNAM-1 activation and regulation could pave the way for novel therapeutic strategies aimed at bolstering anti-tumor immunity. Moreover, the development of DNAM-1 recombinant proteins provides a platform for studying its signaling pathways and therapeutic potential, including the design of DNAM-1 targeted antibodies and fusion proteins that could further enhance the efficacy of existing cancer treatments. With the rapid advancement of biotechnology, ongoing studies focus on the versatility of DNAM-1 in various immune contexts, making it a promising target for enhancing immune responses in a broad spectrum of diseases, from cancer to chronic infections. Researchers are continually exploring its role in shaping immune cell behavior and its implications for improving clinical outcomes in immunotherapy settings.
