Cat: IPD-X19087

Recombinant Mouse CD43 Protein(HEK293), hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD43

  • 简介

    CD43 (mouse) is a major leukocyte surface sialic acid protein that plays a critical regulatory role in T cell function.It positively affects the activation, proliferation, differentiation, trafficking and migration of T cells, particularly by enhancing migration to lymph nodes through ERM proteins.CD43 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD43 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Leukosialin; Ly-48; Sialophorin; CD43; CD43ct; SPN

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P15702

  • Expression Region

    D20-G248

  • AA Sequence

    DSLQRTTMLPSTPHITAPSTSEAQNASPSVSVGSGTVDSKETISPWGQTTIPVSLTPLETTELSSLETSAGASMSTPVPEPTASQEVSSKTSALLPEPSNVASDPPVTAANPVTDGPAANPVTDGTAASTSISKGTSAPPTTVTTSSNETSGPSVATTVSSKTSGPPVTTATGSLGPSSEMHGLPATTATSSVESSSVARGTSVSSRKTSTTSTQDPITTRSPSQESSG

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    72-120 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD43, also known as sialophorin, is a heavily glycosylated transmembrane protein predominantly expressed on the surfaces of leukocytes. It plays a crucial role in various immune responses, including cell adhesion, activation, and migration. The unique structure of CD43, characterized by a long extracellular domain rich in sialic acids, imparts a negative charge that influences cell interactions and signaling pathways. Understanding the function of CD43 is vital for elucidating its role in immune regulation and its potential implications in various diseases, including cancer and autoimmune disorders. Recent studies have focused on the recombinant expression of CD43 to investigate its biological functions and protein interactions in detail. By utilizing recombinant DNA technology, researchers can produce large quantities of CD43, allowing for comprehensive biochemical and biophysical analyses, including structural studies and functional assays. This recombinant approach enables the exploration of CD43's role in immunological contexts, as well as its potential utility as a therapeutic target or biomarker. Advances in biotechnology also facilitate the development of CD43-based therapeutics, such as monoclonal antibodies, that may enhance immune responses against tumors or modulate inflammation in autoimmune conditions. These ongoing studies highlight the importance of CD43 in the immune system and its relevance in both fundamental research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US