Cat: IPD-X21117

Recombinant Human BTN3A1/CD277 Protein(HEK293), Avi & hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BTN3A1/CD277

  • 简介

    BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Butyrophilin subfamily 3 member A1; CD277; BTN3A1; BTF5

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-Avi;C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00481-1

  • Expression Region

    Q30-G254

  • AA Sequence

    QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

  • Protein Length

    Partial

  • Molecular Weight

    58-62 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BTN3A1, also known as CD277, is an intriguing member of the butyrophilin (BTN) family, playing a significant role in immune regulation. It is primarily expressed on antigen-presenting cells and has been implicated in the activation of T cells, particularly in the context of γδ T cell responses. Research indicates that BTN3A1 interacts with the T cell receptor (TCR) and may influence the recognition of non-peptide antigens, thus modulating immune responses against cancer and infectious agents. The protein's ability to act as a co-stimulatory molecule makes it a critical target for immunotherapy. Given the increasing interest in developing effective cancer treatments and understanding autoimmune diseases, BTN3A1/CD277 has gained attention as a potential biomarker and therapeutic target. The production of recombinant BTN3A1 protein facilitates in-depth studies of its structure, function, and interactions, allowing researchers to elucidate its role in immune regulation more precisely. Furthermore, investigating BTN3A1/CD277’s mechanisms may lead to innovative strategies in enhancing T cell responses, paving the way for novel immunotherapeutic applications. As the field of immunology continues to evolve, the functional characterization of BTN3A1/CD277 and its influence on T cell activation are poised to contribute significantly to the development of next-generation cancer therapies and understanding immune system dynamics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US