Analytical Data
-
Gene name
IL-9R
-
简介
Interleukin 9 receptor is a member of the hemopoietin receptor superfamily and interacts with the 7 chain of the IL-2 receptor for signaling. IL-9R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-9R protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-9 is immobilized at 5 μg/mL (100 μL/well) can bind Recombinant Rat IL-9R. The ED50 for this effect is 77.69 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-9 is immobilized at 5 μg/mL (100 μL/well) can bind Recombinant Rat IL-9R. The ED50 for this effect is 77.69 ng/mL.
-
Alternative Names
Interleukin-9 receptor; IL-9R; CD129; IL9R
-
Species
Rat
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE. as determined by SDS-PAGE.
-
Uniprot
G3V8S1
-
Expression Region
M1-A270
-
AA Sequence
MALGRCFPEGCTVEGAAVKQVSWFLIYSCVCSCVCWGVSVPAQEGGRKAGTFTCFSNSVFRIDCHWSAPEPGSRAWLLFTSNQVTDIKHKCTFWDSRCTLVLPKEEAFLPFDNFTITLHRCVMGQEQVSLVDSQYLPRRHIKLDPPSDLQSNVSSGRCVLTWGISFGLEPLITSLSYELAFKRQEEAWEQARLKDRIVGVTWLVLEAIELNPDTIYEARLRVQMALESYDDKTEGEYYKSHWSEWSQSVSFPSPRRKTQGLLIPRWQGSA
-
Protein Length
Partial
-
Molecular Weight
33-40 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-9 receptor (IL-9R) is a critical component of the immune system, primarily associated with the signaling pathways of interleukin-9 (IL-9), a cytokine that plays a significant role in various allergic and inflammatory responses. Research into IL-9R has gained momentum due to its involvement in the pathogenesis of several diseases, including asthma, allergic rhinitis, and certain types of cancer. The IL-9/IL-9R axis is known to influence T-helper cell differentiation, particularly promoting the survival and proliferation of mast cells and enhancing the production of other pro-inflammatory cytokines. This makes IL-9R a potential therapeutic target for modulating immune responses and developing new treatment strategies for allergic diseases and malignancies. The generation of recombinant IL-9R proteins is essential for studying its biological functions, understanding receptor interactions, and screening potential inhibitors or antagonists. Recent advances in recombinant protein technology have enabled the production of high-quality IL-9R for use in various assays, paving the way for deeper insights into its signaling mechanisms and potential clinical applications. Additionally, investigating the structural aspects of IL-9R through crystallography and molecular modeling has provided valuable information that could guide drug design efforts. As research continues, the characterization of IL-9R and its signaling pathways will further clarify its role in immune regulation and disease, highlighting the importance of this receptor in both basic and applied biomedical sciences.











