Cat: IPD-X10874

Recombinant Rat IL-9R Protein (HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-9R

  • 简介

    Interleukin 9 receptor is a member of the hemopoietin receptor superfamily and interacts with the 7 chain of the IL-2 receptor for signaling. IL-9R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-9R protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-9 is immobilized at 5 μg/mL (100 μL/well) can bind Recombinant Rat IL-9R. The ED50 for this effect is 77.69 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Rat IL-9 is immobilized at 5 μg/mL (100 μL/well) can bind Recombinant Rat IL-9R. The ED50 for this effect is 77.69 ng/mL.

  • Alternative Names

    Interleukin-9 receptor; IL-9R; CD129; IL9R

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE. as determined by SDS-PAGE.

  • Uniprot

    G3V8S1

  • Expression Region

    M1-A270

  • AA Sequence

    MALGRCFPEGCTVEGAAVKQVSWFLIYSCVCSCVCWGVSVPAQEGGRKAGTFTCFSNSVFRIDCHWSAPEPGSRAWLLFTSNQVTDIKHKCTFWDSRCTLVLPKEEAFLPFDNFTITLHRCVMGQEQVSLVDSQYLPRRHIKLDPPSDLQSNVSSGRCVLTWGISFGLEPLITSLSYELAFKRQEEAWEQARLKDRIVGVTWLVLEAIELNPDTIYEARLRVQMALESYDDKTEGEYYKSHWSEWSQSVSFPSPRRKTQGLLIPRWQGSA

  • Protein Length

    Partial

  • Molecular Weight

    33-40 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-9 receptor (IL-9R) is a critical component of the immune system, primarily associated with the signaling pathways of interleukin-9 (IL-9), a cytokine that plays a significant role in various allergic and inflammatory responses. Research into IL-9R has gained momentum due to its involvement in the pathogenesis of several diseases, including asthma, allergic rhinitis, and certain types of cancer. The IL-9/IL-9R axis is known to influence T-helper cell differentiation, particularly promoting the survival and proliferation of mast cells and enhancing the production of other pro-inflammatory cytokines. This makes IL-9R a potential therapeutic target for modulating immune responses and developing new treatment strategies for allergic diseases and malignancies. The generation of recombinant IL-9R proteins is essential for studying its biological functions, understanding receptor interactions, and screening potential inhibitors or antagonists. Recent advances in recombinant protein technology have enabled the production of high-quality IL-9R for use in various assays, paving the way for deeper insights into its signaling mechanisms and potential clinical applications. Additionally, investigating the structural aspects of IL-9R through crystallography and molecular modeling has provided valuable information that could guide drug design efforts. As research continues, the characterization of IL-9R and its signaling pathways will further clarify its role in immune regulation and disease, highlighting the importance of this receptor in both basic and applied biomedical sciences.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US