Analytical Data
-
Gene name
BTN3A2
-
简介
BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
- Application
-
Alternative Names
Butyrophilin subfamily 3 member A2; BT3.2; BTF3; BTF4
-
Species
Human
-
Source
HEK293
-
Tag
C-Avi;C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P78410-1
-
Expression Region
Q30-W248
-
AA Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
-
Protein Length
Extracellular Domain
-
Molecular Weight
30-35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BTN3A2, a member of the butyrophilin-like protein family, has garnered attention in immunology and cancer research for its unique role in modulating the immune response. Expressed predominantly in immune cells, BTN3A2 is known to interact with T cell receptors, thereby influencing T cell activation and function. Its involvement in presenting phosphoantigens to Vγ9Vδ2 T cells has opened avenues for exploring BTN3A2 as a potential therapeutic target in cancer immunotherapy. Abnormal expression levels of BTN3A2 in various cancers, such as melanoma and breast cancer, suggest its involvement in tumor immune evasion. Researchers are engaged in generating recombinant BTN3A2 proteins to better understand its structure-function relationships and devise strategies to enhance T cell-mediated anti-tumor responses. As scientists investigate BTN3A2's role in the immune landscape, the development of BTN3A2-targeted strategies may offer innovative approaches for enhancing cancer treatments and managing immune-related disorders. Continued research into BTN3A2's mechanisms could lead to novel immunotherapeutic applications, ultimately improving outcomes for patients facing oncological challenges.
