Cat: IPD-X18995

Recombinant Human B7-2/CD86 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    B7-2/CD86

  • 简介

    B7-2/CD86 protein negatively regulates T-cell activation by disrupting CD86 cluster formation, modulating the T-cell response, and influencing immune activation. B7-2/CD86 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived B7-2/CD86 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Activation B7-2 antigen; B70; BU63; CD86; CD28LG2

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P42081

  • Expression Region

    L26-H245

  • AA Sequence

    LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDH

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    26.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

B7-2 (also known as CD86) is a key co-stimulatory molecule expressed on the surface of antigen-presenting cells (APCs) that plays a crucial role in T cell activation and the immune response. It functions by binding to the CD28 and CTLA-4 receptors on T cells, providing essential signals that promote T cell proliferation, differentiation, and survival. The study of B7-2/CD86 recombinant proteins has gained significant attention in immunology due to their potential applications in cancer immunotherapy, autoimmune diseases, and transplant rejection. Researchers have focused on characterizing the structural and functional properties of B7-2/CD86, as well as developing recombinant forms for therapeutic use. These recombinant proteins can enhance T cell responses by mimicking natural interactions that stimulate the immune system or can be utilized in the creation of checkpoint inhibitors to modulate immune responses in tumor environments. Additionally, understanding the interactions between B7-2/CD86 and its receptors aids in deciphering the mechanisms of immune regulation, which is crucial for designing effective interventions in immune-related disorders. As a result, the exploration of B7-2/CD86 recombinant proteins contributes to advancing both basic immunological knowledge and the development of novel therapeutic strategies aimed at harnessing or downregulating immune responses for clinical benefit.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US