Analytical Data
-
Gene name
B7-2/CD86
-
简介
B7-2/CD86 Protein, Human (HEK293, Fc) is a polypeptide chain with the C-termimal human IgG1 Fc fragment produced in HEK293 cells. B7-2 (CD86) is a costimulatory molecule expressed by antigen-presenting cells (APCs), which interacts with CD28 for T-cell activation and survival and with CTLA4 for immune regulation.
- Application
-
Alternative Names
rHuB7-2/CD86, Fc Chimera; Activation B7-2 antigen; B70; BU63; CD86; CD28LG2
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P42081-1
-
Expression Region
L20-P247
-
AA Sequence
LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP
-
Protein Length
Partial
-
Molecular Weight
65-80 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
B7-2 (also known as CD86) is a key co-stimulatory molecule expressed on the surface of antigen-presenting cells (APCs) that plays a crucial role in T cell activation and the immune response. It functions by binding to the CD28 and CTLA-4 receptors on T cells, providing essential signals that promote T cell proliferation, differentiation, and survival. The study of B7-2/CD86 recombinant proteins has gained significant attention in immunology due to their potential applications in cancer immunotherapy, autoimmune diseases, and transplant rejection. Researchers have focused on characterizing the structural and functional properties of B7-2/CD86, as well as developing recombinant forms for therapeutic use. These recombinant proteins can enhance T cell responses by mimicking natural interactions that stimulate the immune system or can be utilized in the creation of checkpoint inhibitors to modulate immune responses in tumor environments. Additionally, understanding the interactions between B7-2/CD86 and its receptors aids in deciphering the mechanisms of immune regulation, which is crucial for designing effective interventions in immune-related disorders. As a result, the exploration of B7-2/CD86 recombinant proteins contributes to advancing both basic immunological knowledge and the development of novel therapeutic strategies aimed at harnessing or downregulating immune responses for clinical benefit.











