Analytical Data
-
Gene name
CD2
-
简介
CD2 Protein is a cell surface glycoprotein that is expressed on the surface of T cells, NK cells, thymus cells and dendritic cells. The CD2 Protein mediates the adhesion of T cells to various cell types and triggers T cell responses through interactions with lymphocyte function-related antigens CD58 (LFA-3) and CD48/BCM1. CD2 Protein, Canine (HEK293, His) is the recombinant canine-derived CD2 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
T-cell surface antigen CD2; LFA-2; CD2; SRBC
-
Species
Canine
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
XP_849219.1
-
Expression Region
E22-D204
-
AA Sequence
EVLETKLVWGALGHDFDLDSAGFQMNAKIDHIRWEKGKTKVAELKTGILKDTHGKYNISTNGFLKIKHLMMNDSDIYKVAIYDKDGKSVLRRNYQLKIQEKVSTPKILWSCGNQSLTCEITSGTDPTLMLYVNQTMIKNLLNMTIVQWNWTSQQEMTVSCTAKNEVSQKREEKIINCSEKGLD
-
Protein Length
Partial
-
Molecular Weight
35-45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD2, a surface protein predominantly expressed on T cells and natural killer (NK) cells, plays a critical role in the immune response by facilitating cell-cell interactions and activating lymphocytes. The study of CD2 and its recombinant protein has gained prominence due to its involvement in various immunological processes, including T-cell activation, adhesion, and differentiation. Understanding the structure and function of CD2 is crucial for elucidating its role in diseases such as autoimmune disorders, infections, and cancer. Recombinant CD2 proteins provide valuable tools for investigating these processes, allowing researchers to explore the mechanisms of immune cell signaling and interaction. Furthermore, CD2 has potential applications in immunotherapy, as targeting CD2 pathways can enhance anti-tumor responses or restore immune function in compromised systems. Consequently, the development of CD2 recombinant proteins not only aids in basic research but also holds promise for clinical applications in enhancing immune responses and developing novel therapeutic strategies.











