Cat: IPD-X20877

Recombinant Mouse CD2 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD2

  • 简介

    CD2 protein binds to identical proteins and is crucial for immune processes. It participates in T cell activation, cell-cell adhesion, and cytokine production. CD2 is located in cell junctions and the external side of the plasma membrane. It is highly expressed in immune-related tissues like the thymus and spleen, suggesting its importance in immune function. CD2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD2 protein, expressed by HEK293 , with C-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by the ability of the immobilized protein to support the adhesion of Jurkat human T-lymphocyte leukemia cells. The ED50 for this effect is 383.6 ng/ml, corresponding to a specific activity is 2.607×10^3 units/mg. Measured by the ability of the immobilized protein to support the adhesion of Jurkat human T-lymphocyte leukemia cells. The ED50 for this effect is 383.6 ng/mL, corresponding to a specific activity is 2.607×103 units/mg.

  • Alternative Names

    T-cell surface antigen CD2; LFA-3 receptor; LFA-2; CD2; SRBC

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    NP_038514.1

  • Expression Region

    R23-S203

  • AA Sequence

    RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPVIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLSAPFKCEAINPVSKESKTEVVNCPEKGLS

  • Protein Length

    Partial

  • Molecular Weight

    33.79 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD2, a surface protein predominantly expressed on T cells and natural killer (NK) cells, plays a critical role in the immune response by facilitating cell-cell interactions and activating lymphocytes. The study of CD2 and its recombinant protein has gained prominence due to its involvement in various immunological processes, including T-cell activation, adhesion, and differentiation. Understanding the structure and function of CD2 is crucial for elucidating its role in diseases such as autoimmune disorders, infections, and cancer. Recombinant CD2 proteins provide valuable tools for investigating these processes, allowing researchers to explore the mechanisms of immune cell signaling and interaction. Furthermore, CD2 has potential applications in immunotherapy, as targeting CD2 pathways can enhance anti-tumor responses or restore immune function in compromised systems. Consequently, the development of CD2 recombinant proteins not only aids in basic research but also holds promise for clinical applications in enhancing immune responses and developing novel therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US