Analytical Data
-
Gene name
BAFF/TNFSF13B
- Application
-
Alternative Names
Tumor necrosis factor ligand superfamily member 13B; B lymphocyte stimulator; BLyS; B-cell-activating factor; BAFF; Dendritic cell-derived TNF-like molecule; TNF- and APOL-related leukocyte expressed ligand 1; TALL-1
-
Species
Mouse
-
Source
HEK293
-
Tag
N-mFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9WU72-1
-
Expression Region
A127-L309
-
AA Sequence
AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL
-
Protein Length
Full Length of TNFSF13B soluble form
-
Molecular Weight
45-60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BAFF (B-cell activating factor), also known as TNFSF13B, is a critical cytokine belonging to the tumor necrosis factor (TNF) superfamily that plays a vital role in B-cell development, activation, and survival. Dysregulation of BAFF levels has been implicated in various autoimmune diseases, such as systemic lupus erythematosus (SLE) and rheumatoid arthritis, as well as in certain B-cell malignancies. Understanding the structure and function of BAFF is essential for developing targeted therapies aimed at modulating immune responses. Research on recombinant BAFF proteins has gained momentum as these proteins can facilitate the investigation of BAFF's biological activities and mechanisms of action. Additionally, recombinant BAFF can be used as a tool for in vitro assays to explore B-cell signaling pathways and as a potential therapeutic agent to enhance or inhibit B-cell responses in various clinical settings. The generation of well-characterized recombinant BAFF proteins is pivotal for elucidating the cytokine's role in the immune system and for advancing novel treatments for B-cell-related disorders. Recent studies have focused on the production, purification, and functional characterization of these proteins, paving the way for better understanding of their implications in health and disease.











