Analytical Data
-
Gene name
CRACC/SLAMF7
-
简介
The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that complexly regulates immune cell activation and differentiation through finely regulated interactions. Isoform 1 mediates NK cell activation through an SH2D1A-independent ERK-mediated pathway and positively regulates NK cell function dependent on phosphorylated SH2D1B. CRACC/SLAMF7 Protein, Human (HEK293, His) is the recombinant human-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Biological Activity
Immobilized Human SLAMF7 at 2 μg/mL (100 μL/well) can bind SLAMF7 antibody. The ED50 for this effect is 3.111 ng/mL. Immobilized Human SLAMF7 at 2 μg/mL (100 μL/well) can bind SLAMF7 antibody. The ED50 for this effect is 3.111 ng/mL.
-
Alternative Names
SLAM Family Member 7; CD2 Subset 1; CRACC; CD319; SLAMF7; CS1
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NQ25-1
-
Expression Region
S23-M226
-
AA Sequence
SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM
-
Protein Length
Extracellular Domain
-
Molecular Weight
35-44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRACC, also known as SLAMF7 (Signaling Lymphocytic Activation Molecule Family Member 7), is a member of the SLAM family of receptors that play crucial roles in immune system regulation. This protein is primarily expressed on the surface of natural killer (NK) cells and certain leukocyte populations, where it participates in mediating immune responses, particularly in the context of tumor immunity and autoimmune diseases. The study of CRACC/SLAMF7 has gained traction due to its potential as a therapeutic target in cancer immunotherapy. Researchers have observed that SLAMF7 can enhance NK cell activation and cytotoxicity against malignant cells, suggesting that it may boost anti-tumor immunity. Additionally, the understanding of CRACC’s role in modulating immune cell interactions and signaling pathways has opened avenues for developing recombinant proteins that can be harnessed to improve immune responses. Given its unique expression pattern and function, CRACC/SLAMF7 recombinant proteins are being investigated for their ability to engage and activate immune cells, potentially leading to novel treatment strategies for various malignancies. This research is particularly relevant in the era of personalized medicine, where targeted immune therapies are reshaping cancer treatment paradigms. Thus, the recombinant study of CRACC/SLAMF7 is pivotal for uncovering novel therapeutic interventions and enhancing the efficacy of existing immunotherapeutic strategies.











