Cat: IPD-X18645

Recombinant Human CD84/SLAMF5 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD84/SLAMF5

  • 简介

    CD84/SLAMF5 protein is a self-ligand receptor in the SLAM family that regulates the activities of various immune cells through homotypic or heterotypic cell-cell interactions. It fine-tunes its function based on the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 Protein, Human (HEK293, His) is the recombinant human-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SLAM family member 5; CD84; Ly-9B; SLAMF5

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UIB8-1

  • Expression Region

    K22-R220

  • AA Sequence

    KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFR

  • Protein Length

    Partial

  • Molecular Weight

    35-52 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD84, also known as SLAMF5, is a member of the SLAM (Signaling Lymphocytic Activation Molecule) family of proteins, which play crucial roles in the regulation of immune responses, particularly in lymphocytes. The research surrounding CD84/SLAMF5 has garnered significant attention due to its implications in various immunological processes, including cell adhesion, activation, and the formation of immune synapses. Expression of CD84 is primarily found in hematopoietic cells, suggesting its pivotal role in immune system regulation. Dysregulation of CD84 signaling has been implicated in several diseases, including autoimmune disorders and cancers, making it a potential target for therapeutic interventions. Recent studies have focused on characterizing the structure and function of CD84/SLAMF5 to elucidate its signaling pathways and interactions with other immune receptors. Moreover, the development of recombinant CD84 proteins holds great promise for further understanding its biological functions, as well as designing novel immunotherapies. Investigating the recombinant form of CD84/SLAMF5 can provide insights into its role in immune modulation and pave the way for innovative strategies to manipulate immune responses in various clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US