Analytical Data
-
Gene name
CD84/SLAMF5
-
简介
CD84/SLAMF5 protein is a self-ligand receptor in the SLAM family that regulates the activities of various immune cells through homotypic or heterotypic cell-cell interactions. It fine-tunes its function based on the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured in a cell proliferation assay using PHA stimulated Jurkat cells in the presence of anti-CD3. The ED50 for this effect is 1.389 μg/mL in the presence of anti-CD3 immobilized at 2μg/mL, corresponding to a specific activity is 719.942 units/mg. Measured in a cell proliferation assay using PHA stimulated Jurkat cells in the presence of anti-CD3. The ED50 for this effect is 1.389 μg/mL in the presence of anti-CD3 immobilized at 2μg/mL, corresponding to a specific activity is 719.942 units/mg.
-
Alternative Names
SLAM family member 5; CD84; Ly-9B; SLAMF5
-
Species
Rhesus Macaque
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
F6QA53
-
Expression Region
K22-R220
-
AA Sequence
KDSEIITVNGILGESVTFPVNIQEPQQVTNIAWTSKTSVAYVTPGDSEMAPIVAVTHRNYYERIHALGPKYDLVISDLRMEDAGDYKADINTQAEPYTTTKRYNLQVYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEEQELTYTCTAQNPVSNNSDSISARQLCADIAMGLR
-
Protein Length
Partial
-
Molecular Weight
35-50 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD84, also known as SLAMF5, is a member of the SLAM (Signaling Lymphocytic Activation Molecule) family of proteins, which play crucial roles in the regulation of immune responses, particularly in lymphocytes. The research surrounding CD84/SLAMF5 has garnered significant attention due to its implications in various immunological processes, including cell adhesion, activation, and the formation of immune synapses. Expression of CD84 is primarily found in hematopoietic cells, suggesting its pivotal role in immune system regulation. Dysregulation of CD84 signaling has been implicated in several diseases, including autoimmune disorders and cancers, making it a potential target for therapeutic interventions. Recent studies have focused on characterizing the structure and function of CD84/SLAMF5 to elucidate its signaling pathways and interactions with other immune receptors. Moreover, the development of recombinant CD84 proteins holds great promise for further understanding its biological functions, as well as designing novel immunotherapies. Investigating the recombinant form of CD84/SLAMF5 can provide insights into its role in immune modulation and pave the way for innovative strategies to manipulate immune responses in various clinical settings.











