Analytical Data
-
Gene name
IL-17RE
-
简介
Interleukin 17 receptor E (IL-17RE) is a specific functional receptor for IL-17C, and primarily expressed by epithelial cells and lymphocytes, such a Th17 cells[1]. IL-17C/IL-17RE-axis plays a role in many inflammatory and immune diseases[2]. IL-17RE Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 300 amino acids (A115-H414).
- Application
-
Alternative Names
IL-17 RE; IL-17 receptor E; IL17RE; Interleukin 17 receptor E
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
> 90% as determined by SDS-PAGE.
-
Uniprot
Q8BH06
-
Expression Region
A115-H414
-
AA Sequence
AQPSAAEGREHLPEAGSQKCGGPEFSFDLLPEVQAVRVTIPAGPKASVRLCYQWALECEDLSSPFDTQKIVSGGHTVDLPYEFLLPCMCIEASYLQEDTVRRKKCPFQSWPEAYGSDFWQSIRFTDYSQHNQMVMALTLRCPLKLEASLCWRQDPLTPCETLPNATAQESEGWYILENVDLHPQLCFKFSFENSSHVECPHQSGSLPSWTVSMDTQAQQLTLHFSSRTYATFSAAWSDPGLGPDTPMPPVYSISQTQGSVPVTLDLIIPFLRQENCILVWRSDVHFAWKHVLCPDVSHRH
-
Protein Length
Partial
-
Molecular Weight
38-42 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-17 receptor E (IL-17RE) is a member of the interleukin-17 receptor family, playing a crucial role in mediating various biological functions related to inflammation, immune response, and tissue homeostasis. It is primarily known for its involvement in the signaling pathways activated by IL-17 cytokines, which are key players in protecting against microbial infections and in the pathogenesis of autoimmune diseases such as psoriasis, rheumatoid arthritis, and multiple sclerosis. Recent studies have shown that IL-17RE can modulate immune responses by influencing the differentiation of T-helper cells and the activation of innate immune cells. Given its significant role in these processes, research on recombinant IL-17RE protein has gained momentum. Scientists are focusing on its structural characteristics, receptor-ligand interactions, and downstream signaling pathways to better understand its function and potential as a therapeutic target. Recombinant IL-17RE can be employed in various experimental settings to explore its biological activities and therapeutic applications, particularly in modulating inflammatory responses and developing novel treatments for autoimmune disorders. Understanding IL-17RE's role in immune regulation may pave the way for innovative strategies to manipulate immune responses for better clinical outcomes. Furthermore, the development of recombinant proteins for therapeutic use emphasizes the importance of IL-17RE in both basic research and clinical settings, offering insights into its potential as a biomarker or therapeutic target for diseases characterized by dysregulated immune responses.











