Cat: IPD-X18494

Recombinant Mouse IL-21R Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-21R

  • 简介

    The IL-21R protein is specifically designed for IL-21 and forms a heterodimeric complex with the common γ subunit, which is critical for signal transduction. This receptor complex promotes interaction with Janus kinase 1 (JAK1), initiating downstream signaling events in response to interleukin-21. IL-21R Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-21R protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Interleukin-21 receptor; IL-21 receptor; IL-21R; CD360; Nilr

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9JHX3

  • Expression Region

    C20-P236

  • AA Sequence

    CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDP

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    34-38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-21 receptor (IL-21R) is a critical component of the immune system, primarily functioning as a receptor for interleukin-21 (IL-21), a cytokine produced by T follicular helper cells. The IL-21/IL-21R signaling pathway plays a significant role in the regulation of various immune responses, including B cell maturation, proliferation, and antibody production, which are vital for effective humoral immunity. Dysregulation of this pathway has been linked to numerous autoimmune diseases, malignancies, and infections, highlighting its potential as a therapeutic target. Research into IL-21R has intensified in recent years, focusing on its structural biology, signaling mechanisms, and potential as an intervention point for diseases characterized by immune system dysfunction. The development of recombinant IL-21R proteins is particularly noteworthy, as these proteins can be used as tools for elucidating the receptor's biology, exploring the nuances of IL-21 signaling, and ultimately assessing their therapeutic efficacy in treating various immune-related conditions. Engineering soluble forms of IL-21R has facilitated the study of its ligand interactions and downstream signaling pathways, opening new avenues for understanding immune regulation and developing innovative treatments. Overall, the exploration of IL-21R and its signaling pathways represents a promising area of research with implications for improving therapeutic strategies in immunology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US