Analytical Data
-
Gene name
CD158d/KIR2DL4
- Application
-
Alternative Names
rHuCD158d, His; Killer Cell Immunoglobulin-Like Receptor 2DL4; CD158 Antigen-Like Family Member D; KIR-103AS; MHC Class I NK Cell Receptor KIR103AS; CD158d; KIR2DL4; KIR103AS
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
ADY38409.1
-
Expression Region
W22-H242
-
AA Sequence
WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH
-
Protein Length
Partial
-
Molecular Weight
30-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD158d, also known as KIR2DL4, is a member of the killer immunoglobulin-like receptor (KIR) family, which plays a critical role in the regulation of immune responses, particularly in natural killer (NK) cells. KIR2DL4 is unique among KIRs due to its ability to recognize non-peptide ligands, specifically HLA-G, a major histocompatibility complex (MHC) class I molecule implicated in immune tolerance during pregnancy and in tumor escape mechanisms. The interaction between KIR2DL4 and HLA-G is believed to modulate NK cell activity, influencing both immunological tolerance and the immune response to tumors and infections. Research on CD158d/KIR2DL4 recombinant proteins has emerged to better understand the structural and functional aspects of this receptor-ligand interaction. Such studies aim to elucidate how KIR2DL4 contributes to immune regulation and the potential for therapeutic interventions in conditions characterized by immune dysregulation, such as cancer, pregnancy complications, and autoimmune diseases. With advancements in recombinant protein technology, scientists can produce and characterize CD158d/KIR2DL4 proteins, enabling detailed binding studies and functional assays. This research not only enhances our understanding of NK cell biology but also paves the way for the development of novel immunotherapies that harness or inhibit the KIR2DL4-HLA-G pathway in clinical settings.
