Analytical Data
-
Gene name
IL-17RC
-
简介
IL-17RC (Interleukin 17 receptor C), a receptor for IL-17A and IL-17F, is a type I membrane glycoprotein. It is expressed on a variety of nonhematopoietic cell types, and plays a role in inflammatory diseases, including autoimmunity and certain cancers. IL-17RC associates with IL-17RA to form a signaling receptor complex for IL-17A and IL-17F[1][2]. IL-17RC Protein, Human (sf9, His) is produced in Sf9 insect cells with a C-Terminal His-tag.
- Application
-
Alternative Names
Interleukin-17 receptor C; IL-17 receptor C; IL17RC; IL17Rhom; IL-17RL; ZcytoR14
-
Species
Human
-
Source
Baculovirus
-
Tag
C-His
-
Purity
> 90% as determined by SDS-PAGE.
-
Uniprot
Q8NAC3
-
Expression Region
L21-A454
-
AA Sequence
LERLVGPQDATHCSPGLSCRLWDSDILCLPGDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNHTQQLPALPWLNVSADGDNVHLVLNVSEEQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLEPDSVRTNICPFREDPRAHQNLWQAARLQLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWENVTVDKVLEFPLLKGHPNLCVQVNSSEKLQLQECLWADSLGPLKDDVLLLETRGPQDNRSLCALEPSGCTSLPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIHKRWA
-
Protein Length
Partial
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-17 receptor C (IL-17RC) plays a pivotal role in the immune response and is part of the IL-17 receptor family, which is involved in various inflammatory diseases and autoimmune conditions. IL-17 cytokines, particularly IL-17A and IL-17F, have been linked to the recruitment and activation of immune cells, promoting pro-inflammatory pathways. Research has highlighted the significance of IL-17RC as a crucial co-receptor for IL-17A and IL-17F, amplifying the signaling cascade that leads to chronic inflammation. This engagement with IL-17A/F has made IL-17RC a potential therapeutic target for conditions like psoriasis, rheumatoid arthritis, and other inflammatory disorders. Furthermore, understanding the structure and function of IL-17RC through the development of recombinant protein has opened avenues for novel therapeutic interventions and biomarker discovery. Studies have focused on characterizing the recombinant form of IL-17RC to elucidate its functional mechanisms and examine its interaction with cytokines in the IL-17 family. This knowledge could help in designing targeted therapies that modulate the immune response without broad immunosuppression, paving the way for more effective treatments for patients suffering from IL-17-mediated pathologies.
