Analytical Data
-
Gene name
TNFRSF11B/OPG
-
简介
Osteoprotegerin (OPG), a TNF receptor superfamily, is expressed in many tissues including heart, kidney, liver, spleen, and bone marrow. Osteoprotegerin has osteoprotective effect and is critical in bone remodeling. Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis[1]. OPG is also involved in multiple biological processes of cancers. TNFRSF11B/OPG Protein, Rhesus Macaque (HEK293, hFc) is a recombinant Rhesus Macaque TNFRSF11B/OPG (M28-L428) with C-terminal hFc tag, which is produced in HEK293 cell[1][2].
- Application
-
Biological Activity
Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L 929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 6.472 ng/mL in the presence of 20 ng/mL of recombinant human TRAIL, corresponding to a specific activity is 1.545×10[5] units/mg. Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L 929 mouse fibroblast cells treated with TRAIL.The ED50 for this effect is 6.472 ng/mL in the presence of 20 ng/mL of recombinant human TRAIL, corresponding to a specific activity is 1.545×105 units/mg.
-
Alternative Names
OCIF; OPG; OPGtumor necrosis factor receptor superfamily member 11B
-
Species
Rhesus Macaque
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
XP_001096915
-
Expression Region
M28-L428
-
AA Sequence
MNKLLCCALVFLDISIKWTTQETFPPKYLHYDQETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRRHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTTKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
-
Protein Length
Partial
-
Molecular Weight
80-95 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFRSF11B, also known as osteoprotegerin (OPG), is a crucial member of the tumor necrosis factor receptor superfamily that plays a significant role in bone metabolism and immune regulation. It functions primarily as a decoy receptor for RANKL (Receptor Activator of Nuclear Factor Kappa-Β Ligand), inhibiting osteoclastogenesis, promoting bone formation, and maintaining bone density. Dysregulation of the OPG/RANK/RANKL pathway is implicated in various pathological conditions, including osteoporosis, inflammation, and certain cancers. Given its pivotal role in these processes, research into recombinant OPG proteins has gained traction as a potential therapeutic strategy. Recombinant OPG can be engineered to enhance its stability and efficacy, offering promising avenues for treating bone-related diseases and modulating immune responses. While ongoing studies aim to elucidate the precise mechanisms of OPG, including its role in angiogenesis and tumor progression, the development of recombinant OPG-based therapies represents a novel approach to address challenges in skeletal health and immunological disorders. Understanding the implications of TNFRSF11B/OPG in both normal physiology and disease states continues to be a prominent focus in biomedical research, paving the way for innovative clinical applications.
