Analytical Data
-
Gene name
TNFRSF11B/OPG
-
简介
TNFRSF11B/OPG acts as a decoy receptor for TNFSF11/RANKL, neutralizing its osteoclastic effects and promoting osteoclast apoptosis in vitro. It regulates the TNFSF11/TNFRSF11B ratio and is critical for bone homeostasis. TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived TNFRSF11B/OPG protein, expressed by HEK293 , with C-hFc, C-Flag labeled tag.
- Application
-
Alternative Names
Tumor Necrosis Factor Receptor Superfamily Member 11B; Osteoclastogenesis Inhibitory Factor; Osteoprotegerin; TNFRSF11B; OCIF; OPG
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc;C-Flag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00300
-
Expression Region
E22-L401
-
AA Sequence
ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
85kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFRSF11B, also known as osteoprotegerin (OPG), is a crucial member of the tumor necrosis factor receptor superfamily that plays a significant role in bone metabolism and immune regulation. It functions primarily as a decoy receptor for RANKL (Receptor Activator of Nuclear Factor Kappa-Β Ligand), inhibiting osteoclastogenesis, promoting bone formation, and maintaining bone density. Dysregulation of the OPG/RANK/RANKL pathway is implicated in various pathological conditions, including osteoporosis, inflammation, and certain cancers. Given its pivotal role in these processes, research into recombinant OPG proteins has gained traction as a potential therapeutic strategy. Recombinant OPG can be engineered to enhance its stability and efficacy, offering promising avenues for treating bone-related diseases and modulating immune responses. While ongoing studies aim to elucidate the precise mechanisms of OPG, including its role in angiogenesis and tumor progression, the development of recombinant OPG-based therapies represents a novel approach to address challenges in skeletal health and immunological disorders. Understanding the implications of TNFRSF11B/OPG in both normal physiology and disease states continues to be a prominent focus in biomedical research, paving the way for innovative clinical applications.











