Cat: IPD-X18013

Recombinant Human TNFRSF11B/OPG Protein(HEK293) , hFc & Flag

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNFRSF11B/OPG

  • 简介

    TNFRSF11B/OPG acts as a decoy receptor for TNFSF11/RANKL, neutralizing its osteoclastic effects and promoting osteoclast apoptosis in vitro. It regulates the TNFSF11/TNFRSF11B ratio and is critical for bone homeostasis. TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived TNFRSF11B/OPG protein, expressed by HEK293 , with C-hFc, C-Flag labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Tumor Necrosis Factor Receptor Superfamily Member 11B; Osteoclastogenesis Inhibitory Factor; Osteoprotegerin; TNFRSF11B; OCIF; OPG

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc;C-Flag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00300

  • Expression Region

    E22-L401

  • AA Sequence

    ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    85kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TNFRSF11B, also known as osteoprotegerin (OPG), is a crucial member of the tumor necrosis factor receptor superfamily that plays a significant role in bone metabolism and immune regulation. It functions primarily as a decoy receptor for RANKL (Receptor Activator of Nuclear Factor Kappa-Β Ligand), inhibiting osteoclastogenesis, promoting bone formation, and maintaining bone density. Dysregulation of the OPG/RANK/RANKL pathway is implicated in various pathological conditions, including osteoporosis, inflammation, and certain cancers. Given its pivotal role in these processes, research into recombinant OPG proteins has gained traction as a potential therapeutic strategy. Recombinant OPG can be engineered to enhance its stability and efficacy, offering promising avenues for treating bone-related diseases and modulating immune responses. While ongoing studies aim to elucidate the precise mechanisms of OPG, including its role in angiogenesis and tumor progression, the development of recombinant OPG-based therapies represents a novel approach to address challenges in skeletal health and immunological disorders. Understanding the implications of TNFRSF11B/OPG in both normal physiology and disease states continues to be a prominent focus in biomedical research, paving the way for innovative clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US